Prompt category

Marketing prompts

Reusable ChatGPT prompts for marketing workflows.

166 published prompts

Find a prompt

Search marketing prompts.

Marketing Campaigns 4 steps

Email: Ideal Customer Persona and Product/Service

Learn how to craft a persuasive marketing email tailored to your ideal customer persona to effectively promote your product or service and increase sales.

copywritingemailmarketing
SEO 3 steps

Analyze Keyword Search Intent Instantly

Classify keywords into search intent categories—Informational, Navigational, Commercial, or Transactional—based on the purpose behind the search query in TARGETLANGUAGE. Present the results in a table for easy interpretation.

marketingseokeyword-researchsearch-intent
Market Research 5 steps

Target audiences with partnerships

Act as a market research expert fluent in TARGETLANGUAGE and list ten types of companies suitable for brand partnerships to reach the target audience. For each type, provide a name, an emoji, the benefit to your brand, and the benefit to the partner brand. Output all informat

marketingmarket-researchpartnerships
SEO 6 steps

Detailed Amazon Optimised Listing Creator V 1.0

Create a powerful, SEO-optimized Amazon product listing including a compelling title, styled description with a bolded introductory title and four unique selling points based on product features, detailed bullet points with technical details, and backend search terms, all crafted

amazonlistingseomarketing
Marketing Campaigns 8 steps

Generate Product Collection Summary (+Meta fields & H1)

Assume the role of an e-commerce SEO expert and create a compelling and keyword-rich summary for a collection page based on the provided list of products. The summary should be informative, captivating, under 600 words, and use emotional and persuasive language to encourage purch

copywritingmarketingseo
Video SEO 3 steps

SEO Optimized YouTube Type Beat - Title, Description and Tags

Generate a SEO-optimized YouTube video title, description, and tags for a type beat inspired by a specified artist. Include a fitting random beat name in the title, keep title under 100 characters (preferably 70), create an effective description under 5000 characters that starts

seoyoutubetype-beatmusic-marketing
Social Posts 4 steps

Boost Your Social Media Engagement: Proven Content Ideas

Generate 10 unique and engaging social media post ideas tailored to the demographics and interests of the target audience for PROMPT. These ideas will include a mix of text, image, and video content designed to increase engagement and drive website traffic. All posts are writ

social-mediacontent-ideasengagementaudience-research
Marketing Campaigns 5 steps

Email Marketing Series Outline

Create a well-structured email marketing sequence tailored to a specific product or service. Research the target audience's demographics to craft appealing emails that guide leads toward booking a discovery call. Each email includes a compelling subject line and a brief outline o

copywritingmarketingemail-marketing
Content Strategy 8 steps

Create A Content Plan for Specific Pillar Content (Silo Structure)

Develop a comprehensive content strategy using the pillar content and silo structure approach centered on the primary keyword PROMPT. As a Marketing Director managing multiple websites with a fluent TARGETLANGUAGE team, create detailed objectives, identify related keyword

marketingcontent-strategyseoresearch
Marketing Strategy 4 steps

Create The Perfect Marketing Persona

Act as a professional marketer to generate a detailed marketing persona based on the provided product information and general knowledge of the target audience. The persona includes demographic and psychographic details, goals, pain points, communication preferences, buying habits

marketingmarketing-strategypersona-creationcopywriting
Copywriting 6 steps

Generate Top Level Catchy Call-to-Action Sentences on Any Topic

Act as a highly skilled marketer and copywriter fluent in TARGETLANGUAGE to generate at least 20 catchy, human-written, suspenseful call-to-action sentences related to the topic PROMPT. Most CTAs should be testimonial or example-based, using pronouns or names suitable for

copywritingmarketing
SEO 10 steps

Fiverr Gig Description PRO: Title, Service, Bullet Points, Keyword Research

Create an 850-word Fiverr gig description featuring a compelling gig title, five relevant SEO keywords, an attractive bolded description, concise feature bullet points, reasons why your service excels, included SEO services, a short closing statement, and a prompt to contact befo

marketingseo